CacheBy
Atlas Antibodies Anti-SPACA9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPACA9 Antibody

상품 한눈에 보기

Human SPACA9 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 제품입니다. Rabbit 유래 IgG 항체로, PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051600-100 Anti-SPACA9 Antibody, sperm acrosome associated 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051600-25 Anti-SPACA9 Antibody, sperm acrosome associated 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPACA9 Antibody

Anti-SPACA9 Antibody

Target: sperm acrosome associated 9 (SPACA9)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SPACA9


Alternative Gene Names

  • C9orf9
  • Mast

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein sperm acrosome associated 9
Target Gene SPACA9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012697 (93%), Mouse ENSMUSG00000026809 (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFE

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.