Atlas Antibodies Anti-SPACA7 Antibody

상품 한눈에 보기

인간 SPACA7 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인체 반응성 확인 및 다양한 조직 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048349-100 Anti-SPACA7 Antibody, sperm acrosome associated 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048349-25 Anti-SPACA7 Antibody, sperm acrosome associated 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Sperm acrosome associated 7 (SPACA7)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human SPACA7

항목	내용
Target Protein	Sperm acrosome associated 7
Target Gene	SPACA7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000010435 (43%), Rat ENSRNOG00000054006 (36%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.