Atlas Antibodies Anti-SORBS2 Antibody

상품 한눈에 보기

인간 SORBS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. ARGBP2, KIAA0777 유전자와 관련된 연구에 사용되며, 고순도 친화정제 방식으로 제조되었습니다. 인간에 대한 반응성이 검증되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036755-100 Anti-SORBS2 Antibody, sorbin and SH3 domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036755-25 Anti-SORBS2 Antibody, sorbin and SH3 domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SORBS2 Antibody

Anti-SORBS2 Antibody

Target: sorbin and SH3 domain containing 2 (SORBS2)
Type: Polyclonal Antibody against Human SORBS2

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody targets the human SORBS2 protein, also known as sorbin and SH3 domain containing 2. It is affinity purified using the PrEST antigen as an affinity ligand.

Alternative Gene Names

ARGBP2
KIAA0777

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	sorbin and SH3 domain containing 2
Target Gene	SORBS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PRDSPRAISFKNGWQMARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPMAWGSPYVPEVRSNGRSR

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000031626	88%
Rat	ENSRNOG00000013391	84%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen