
Atlas Antibodies Anti-SORBS2 Antibody
상품 한눈에 보기
인간 SORBS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. ARGBP2, KIAA0777 유전자와 관련된 연구에 사용되며, 고순도 친화정제 방식으로 제조되었습니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SORBS2 Antibody
Target: sorbin and SH3 domain containing 2 (SORBS2)
Type: Polyclonal Antibody against Human SORBS2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody targets the human SORBS2 protein, also known as sorbin and SH3 domain containing 2. It is affinity purified using the PrEST antigen as an affinity ligand.
Alternative Gene Names
- ARGBP2
- KIAA0777
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sorbin and SH3 domain containing 2 |
| Target Gene | SORBS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PRDSPRAISFKNGWQMARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPMAWGSPYVPEVRSNGRSR |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000031626 | 88% |
| Rat | ENSRNOG00000013391 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SORCS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SORBS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SORBS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SORBS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SORBS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.