CacheBy
Atlas Antibodies Anti-SORBS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SORBS3 Antibody

상품 한눈에 보기

Human SORBS3 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. SCAM-1, SH3D4, vinexin 등 대체 유전자명과 교차 반응 정보 제공. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015849-100 Anti-SORBS3 Antibody, sorbin and SH3 domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015849-25 Anti-SORBS3 Antibody, sorbin and SH3 domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SORBS3 Antibody

Anti-SORBS3 Antibody

Target: sorbin and SH3 domain containing 3 (SORBS3)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human SORBS3.


Alternative Gene Names

  • SCAM-1
  • SH3D4
  • vinexin

Open Datasheet


Target Information

항목 내용
Target Protein sorbin and SH3 domain containing 3
Target Gene SORBS3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GPASAWSSSYPHAPYLGSARSLSPHKMADGGSPFLGRRDFVYPSSTRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000008829 83%
Mouse ENSMUSG00000022091 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.