CacheBy
Atlas Antibodies Anti-SORBS2 Antibody
원본

Atlas Antibodies Anti-SORBS2 Antibody

상품 한눈에 보기

Human SORBS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. ARGBP2, KIAA0777 유전자 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036754-100 Anti-SORBS2 Antibody, sorbin and SH3 domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036754-25 Anti-SORBS2 Antibody, sorbin and SH3 domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SORBS2 Antibody

Anti-SORBS2 Antibody

Target: sorbin and SH3 domain containing 2
Type: Polyclonal Antibody against Human SORBS2


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human SORBS2 protein.
Alternative gene names: ARGBP2, KIAA0777
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein sorbin and SH3 domain containing 2
Target Gene SORBS2
Alternative Gene Names ARGBP2, KIAA0777
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PRDSPRAISFKNGWQMARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPMAWGSPYVPEVRSNGRSR
Verified Species Reactivity Human
Interspecies Identity Mouse (88%), Rat (84%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.