
Atlas Antibodies Anti-SNRPB Antibody
Human SNRPB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. siRNA knockdown으로 유전적 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, Human, Mouse, Rat에 반응합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SNRPB Antibody
Target: small nuclear ribonucleoprotein polypeptides B and B1
Type: Polyclonal Antibody against Human SNRPB
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal antibody targeting SNRPB (small nuclear ribonucleoprotein polypeptides B and B1). Suitable for detection in multiple species and validated through genetic methods.
Alternative Gene Names
COD, Sm-B/B, SmB/SmB, snRNP-B, SNRPB1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | small nuclear ribonucleoprotein polypeptides B and B1 |
| Target Gene | SNRPB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000059764 (100%)
- Mouse ENSMUSG00000102252 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SNRPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNRPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNRPB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNRPB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNRPA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|