Atlas Antibodies Anti-SNRPB Antibody

상품 한눈에 보기

Human SNRPB 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. siRNA knockdown으로 유전학적 검증 완료. 고순도 Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003482-100 Anti-SNRPB Antibody, small nuclear ribonucleoprotein polypeptides B and B1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003482-25 Anti-SNRPB Antibody, small nuclear ribonucleoprotein polypeptides B and B1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: small nuclear ribonucleoprotein polypeptides B and B1
Supplier: Atlas Antibodies

Polyclonal antibody against Human SNRPB.

COD, Sm-B/B, SmB/SmB, snRNP-B, SNRPB1

항목	내용
Target Protein	small nuclear ribonucleoprotein polypeptides B and B1
Target Gene	SNRPB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000059764 (100%), Mouse ENSMUSG00000102252 (100%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)