CacheBy
Atlas Antibodies Anti-SNRPA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNRPA1 Antibody

상품 한눈에 보기

Human SNRPA1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 보장. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045622-100 Anti-SNRPA1 Antibody, small nuclear ribonucleoprotein polypeptide A` 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045622-25 Anti-SNRPA1 Antibody, small nuclear ribonucleoprotein polypeptide A` 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNRPA1 Antibody

Anti-SNRPA1 Antibody

Target Protein: small nuclear ribonucleoprotein polypeptide A
Alternative Gene Name: Lea1

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SNRPA1.

Open Datasheet

Target Information

항목 내용
Target Protein small nuclear ribonucleoprotein polypeptide A
Target Gene SNRPA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (99%)

Antigen Sequence:
VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.