
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMARCC1 Antibody
상품 한눈에 보기
Human SMARCC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 실험에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. 높은 종간 반응성(인간, 생쥐, 랫드) 확보. PrEST 항원을 이용한 친화 정제 방식 적용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA026853-100 Anti-SMARCC1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026853-25 Anti-SMARCC1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMARCC1 Antibody
Anti-SMARCC1 Antibody
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간의 orthogonal 검증 수행
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SMARCC1
Alternative Gene Names
BAF155, CRACC1, Rsc8, SRG3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 |
| Target Gene | SMARCC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000020804 (95%), Mouse ENSMUSG00000032481 (94%) |
Antigen Sequence:
LLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



