원본

Atlas Antibodies Anti-SMARCD3 Antibody

상품 한눈에 보기

인간 SMARCD3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. RNA-seq 데이터 기반 Orthogonal validation 완료. 다양한 연구용으로 활용 가능합니다.

카탈로그번호: HPA065517-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065517-100 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065517-25 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SMARCD3 Antibody

Anti-SMARCD3 Antibody

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SMARCD3

Alternative Gene Names

BAF60C, CRACD3, Rsc6p

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Target Gene	SMARCD3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000028949 (100%) Rat ENSRNOG00000010077 (56%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand