
Atlas Antibodies Anti-SMARCB1 Antibody
상품 한눈에 보기
Human SMARCB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. 인간, 마우스, 랫트에 반응하며 염색질 조절 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SMARCB1 Antibody
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Independent validation by comparing antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human SMARCB1
Alternative Gene Names
BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Target Gene | SMARCB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000000902 | 100% |
| Rat | ENSRNOG00000061740 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SMARCC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMARCC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMARCB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMARCB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMARCAD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.