CacheBy
Atlas Antibodies Anti-SMARCB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMARCB1 Antibody

상품 한눈에 보기

Human SMARCB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. 인간, 마우스, 랫트에 반응하며 염색질 조절 연구에 활용 가능.

카탈로그번호
HPA018248-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018248-100 Anti-SMARCB1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018248-25 Anti-SMARCB1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMARCB1 Antibody

Anti-SMARCB1 Antibody

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Independent validation by comparing antibodies targeting different epitopes of the protein
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SMARCB1

Alternative Gene Names

BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1

Open Datasheet

Target Information

항목 내용
Target Protein SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Target Gene SMARCB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000000902 100%
Rat ENSRNOG00000061740 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.