Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
Rabbit polyclonal antibody targeting KV1.2 (KCNA2) for WB, IHC, and ICC applications. Recognizes amino acids 417–499 of rat KV1.2. Lyophilized form, 0.8 mg/mL concentration. Ideal for research on voltage-gated potassium channel functions.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:200 |
| Immunohistochemistry (IHC) | 1:200 |
| Immunocytochemistry (ICC/IF) | 1:200 |
Product Specifications
| Property | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417–499 of rat KV1.2 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736054 |
Product Specific Information
Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.
Target Information
Kcna2 is a voltage-gated potassium channel (KV) belonging to the 6-TM family of potassium channels, which also includes Ca2+-activated Slo (7-TM) and SK subfamilies.
The alpha-subunits form tetramers with a single pore-forming region. Potassium channels regulate neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
Four sequence-related potassium channel genes—shaker, shaw, shab, and shal—have been identified in Drosophila, each with human homologs.
The Kcna2 gene encodes a member of the voltage-gated, shaker-related potassium channel subfamily. It contains six membrane-spanning domains with a shaker-type repeat in the fourth segment and belongs to the delayed rectifier class, enabling efficient nerve cell repolarization after action potentials.
The coding region of Kcna2 is intronless and clustered with genes KCNA3 and KCNA10 on chromosome 1.
Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.