
Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
Rabbit polyclonal antibody targeting KV1.2 (KCNA2) for WB, IHC, and ICC applications. Recognizes amino acids 417–499 of rat KV1.2. Lyophilized form, 0.8 mg/mL concentration. Ideal for research on voltage-gated potassium channel functions.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:200 |
| Immunohistochemistry (IHC) | 1:200 |
| Immunocytochemistry (ICC/IF) | 1:200 |
Product Specifications
| Property | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417–499 of rat KV1.2 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736054 |
Product Specific Information
Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.
Target Information
Kcna2 is a voltage-gated potassium channel (KV) belonging to the 6-TM family of potassium channels, which also includes Ca2+-activated Slo (7-TM) and SK subfamilies.
The alpha-subunits form tetramers with a single pore-forming region. Potassium channels regulate neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
Four sequence-related potassium channel genes—shaker, shaw, shab, and shal—have been identified in Drosophila, each with human homologs.
The Kcna2 gene encodes a member of the voltage-gated, shaker-related potassium channel subfamily. It contains six membrane-spanning domains with a shaker-type repeat in the fourth segment and belongs to the delayed rectifier class, enabling efficient nerve cell repolarization after action potentials.
The coding region of Kcna2 is intronless and clustered with genes KCNA3 and KCNA10 on chromosome 1.
Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific KV2.1 (KCNB1) Polyclonal Antibody
949,900원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNH2 Polyclonal Antibody
943,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
949,900원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.1 (KCNA1) Polyclonal Antibody
949,900원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
949,900원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|