Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
KV1.4 (KCNA4) 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF 등 다양한 응용 가능. Lyophilized 형태로 제공되며, 재구성 후 -20°C 보관. 심장 전위 조절 관련 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
Applications
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:200 | |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-Dependent | |
| Immunocytochemistry (ICC/IF) | 1:200 |
Product Specifications
| Item | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589–655 of rat KV1.4 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.3 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736058 |
Product Specific Information
Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.
Target Information
Potassium voltage-gated channel subfamily A member 4 (Kv1.4 or PCN2) is encoded by the KCNA4 gene in humans.
This gene belongs to the voltage-gated, shaker-related potassium channel subfamily and is mapped to chromosome 11p14.1.
KCNA4 contributes to the A-type potassium current, which regulates the fast repolarizing phase of cardiac action potentials and influences cardiac duration.
It also participates in the transient outward potassium current (Ito1), a major component of the repolarizing phase 1 of the cardiac action potential.
Interactions have been reported with DLG4, KCNA2, and DLG1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.