Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
KV1.4 (KCNA4) 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF 등 다양한 응용 가능. Lyophilized 형태로 제공되며, 재구성 후 -20°C 보관. 심장 전위 조절 관련 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:200 | |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-Dependent | |
| Immunocytochemistry (ICC/IF) | 1:200 |
Product Specifications
| Item | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589–655 of rat KV1.4 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.3 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736058 |
Product Specific Information
Product is shipped at room temperature as a lyophilized powder and should be stored at -20°C upon receipt.
Reconstitution: add 50 µL of deionized water.
Target Information
Potassium voltage-gated channel subfamily A member 4 (Kv1.4 or PCN2) is encoded by the KCNA4 gene in humans.
This gene belongs to the voltage-gated, shaker-related potassium channel subfamily and is mapped to chromosome 11p14.1.
KCNA4 contributes to the A-type potassium current, which regulates the fast repolarizing phase of cardiac action potentials and influences cardiac duration.
It also participates in the transient outward potassium current (Ito1), a major component of the repolarizing phase 1 of the cardiac action potential.
Interactions have been reported with DLG4, KCNA2, and DLG1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.1 (KCNA1) Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Kir3.2 (KCNJ6) Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Kir3.1 (KCNJ3) Polyclonal Antibody
922,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|