CacheBy
Thermo Fisher Scientific IGFBP3 Polyclonal Antibody
원본

Thermo Fisher Scientific IGFBP3 Polyclonal Antibody

상품 한눈에 보기

IGFBP3 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ELISA에 적합합니다. 고순도 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 인간, 마우스, 랫트 반응성.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오후 11:29
Thermo Fisher Scientific PA579451 IGFBP3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific IGFBP3 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
ELISA 0.1–0.5 µg/mL

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214–252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746567

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

IGFBP3 (Insulin-like Growth Factor Binding Protein 3)은 IGFBP 패밀리에 속하는 유전자로, IGFBP 도메인과 thyroglobulin type-I 도메인을 포함한 단백질을 암호화합니다. 이 단백질은 IGFALS 및 IGF-I 또는 IGF-II와 삼중 복합체를 형성하여 혈장 내에서 순환하며 IGF의 반감기를 연장하고 세포 표면 수용체와의 상호작용을 조절합니다. 다양한 전사적 스플라이스 변이로 인해 여러 이소폼이 존재합니다. IGFBP3 관련 질환에는 Insulin-Like Growth Factor I 및 Acid-Labile Subunit Deficiency가 포함됩니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.