CacheBy
Atlas Antibodies Anti-FBXL17 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXL17 Antibody

상품 한눈에 보기

Human FBXL17 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036411-100 Anti-FBXL17 Antibody, F-box and leucine-rich repeat protein 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036411-25 Anti-FBXL17 Antibody, F-box and leucine-rich repeat protein 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXL17 Antibody

Anti-FBXL17 Antibody

F-box and leucine-rich repeat protein 17

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human FBXL17.

Alternative Gene Names

DKFZP434C1715, Fbl17, Fbx13, FBXO13

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein F-box and leucine-rich repeat protein 17
Target Gene FBXL17
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYK

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000013875 99%
Mouse ENSMUSG00000023965 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.