CacheBy
Atlas Antibodies Anti-FBXL17 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXL17 Antibody

상품 한눈에 보기

인간 FBXL17 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 실험에 적합. 토끼 유래 IgG 아이소타입으로 고순도 친화 정제. 인간에 높은 반응성을 가지며 쥐와 생쥐에서도 높은 항원 서열 일치율.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036410-100 Anti-FBXL17 Antibody, F-box and leucine-rich repeat protein 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036410-25 Anti-FBXL17 Antibody, F-box and leucine-rich repeat protein 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXL17 Antibody

Anti-FBXL17 Antibody

제품 개요

  • Target Protein: F-box and leucine-rich repeat protein 17
  • 제품 유형: Polyclonal Antibody against Human FBXL17
  • Recommended Applications: IHC, ICC

Alternative Gene Names

DKFZP434C1715, Fbl17, Fbx13, FBXO13

Open Datasheet

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000013875 (99%)
  • Mouse ENSMUSG00000023965 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.