CacheBy
Atlas Antibodies Anti-FBXL16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXL16 Antibody

상품 한눈에 보기

인간 FBXL16 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 설치류 간 높은 서열 동일성. 연구용 단백질 발현 검증에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056354-100 Anti-FBXL16 Antibody, F-box and leucine-rich repeat protein 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056354-25 Anti-FBXL16 Antibody, F-box and leucine-rich repeat protein 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXL16 Antibody

Anti-FBXL16 Antibody

F-box and leucine-rich repeat protein 16


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human FBXL16.


Alternative Gene Names

C16orf22, Fbl16, MGC33974

Open Datasheet


Target Information

항목 내용
Target Protein F-box and leucine-rich repeat protein 16
Target Gene FBXL16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000022248 (98%), Mouse ENSMUSG00000025738 (98%)

Antigen Sequence:
ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.