Atlas Antibodies Anti-FBXL16 Antibody

상품 한눈에 보기

인간 FBXL16 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 설치류 간 높은 서열 동일성. 연구용 단백질 발현 검증에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056354-100 Anti-FBXL16 Antibody, F-box and leucine-rich repeat protein 16 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056354-25 Anti-FBXL16 Antibody, F-box and leucine-rich repeat protein 16 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

F-box and leucine-rich repeat protein 16

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against human FBXL16.

C16orf22, Fbl16, MGC33974

항목	내용
Target Protein	F-box and leucine-rich repeat protein 16
Target Gene	FBXL16
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000022248 (98%), Mouse ENSMUSG00000025738 (98%)

Antigen Sequence:
ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand