
Atlas Antibodies Anti-FBXL16 Antibody
인간 FBXL16 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 설치류 간 높은 서열 동일성. 연구용 단백질 발현 검증에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FBXL16 Antibody
F-box and leucine-rich repeat protein 16
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human FBXL16.
Alternative Gene Names
C16orf22, Fbl16, MGC33974
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | F-box and leucine-rich repeat protein 16 |
| Target Gene | FBXL16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000022248 (98%), Mouse ENSMUSG00000025738 (98%) |
Antigen Sequence:ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FBXL19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXL17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXL16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXL17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXL16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|