
Thermo Fisher Scientific NR3C2 Polyclonal Antibody
NR3C2 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 최적화되어 있으며 인간, 마우스, 랫트 반응성을 보임. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950–984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746876 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Steroid receptors are ligand-dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone.
Mineralocorticoids are a family of steroids secreted by the adrenal cortex, necessary for the regulation of metabolic processes including electrolyte balance.
These compounds exert their effect through interaction with the mineralocorticoid receptor (MR) and subsequent association with DNA.
The kidney is a primary target organ for mineralocorticoids and contains MR. The corresponding gene for the mineralocorticoid receptor is NR3C2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Mimecan Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NSF Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NR3C2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NRF1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Podocin Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|