Thermo Fisher Scientific NR3C2 Polyclonal Antibody
NR3C2 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 최적화되어 있으며 인간, 마우스, 랫트 반응성을 보임. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.
- 카탈로그번호
- PA579761
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific NR3C2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950–984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746876 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Steroid receptors are ligand-dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone.
Mineralocorticoids are a family of steroids secreted by the adrenal cortex, necessary for the regulation of metabolic processes including electrolyte balance.
These compounds exert their effect through interaction with the mineralocorticoid receptor (MR) and subsequent association with DNA.
The kidney is a primary target organ for mineralocorticoids and contains MR. The corresponding gene for the mineralocorticoid receptor is NR3C2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.