Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody
EpCAM(CD326)을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, Flow Cytometry, ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. EpCAM 관련 암 연구 및 세포접착 단백질 분석에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147–189 aa: ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746323 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Ep-CAM (epithelial adhesion molecule, ESA) is a transmembrane glycoprotein (~40 kDa) expressed in epithelial tissues. It functions as a calcium-independent cell adhesion molecule and influences cell cycle, proliferation, and metabolism by inducing proto-oncogene c-myc and cyclins A and E.
Ep-CAM-mediated adhesions negatively regulate cadherin-mediated adhesions, affecting epithelial differentiation and growth. Overexpression of Ep-CAM is associated with enhanced epithelial proliferation and is highly expressed in human carcinomas, serving as a marker for epithelial-derived tumors. It is found on baso-lateral surfaces of most simple epithelia and many carcinoma types, and can distinguish adenocarcinomas from pleural mesotheliomas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ELF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Emerin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HIF-2 alpha Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD105 (Endoglin) Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|