Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody
EpCAM(CD326)을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, Flow Cytometry, ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. EpCAM 관련 암 연구 및 세포접착 단백질 분석에 적합.
- 카탈로그번호
- PA579207
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147–189 aa: ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746323 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Ep-CAM (epithelial adhesion molecule, ESA) is a transmembrane glycoprotein (~40 kDa) expressed in epithelial tissues. It functions as a calcium-independent cell adhesion molecule and influences cell cycle, proliferation, and metabolism by inducing proto-oncogene c-myc and cyclins A and E.
Ep-CAM-mediated adhesions negatively regulate cadherin-mediated adhesions, affecting epithelial differentiation and growth. Overexpression of Ep-CAM is associated with enhanced epithelial proliferation and is highly expressed in human carcinomas, serving as a marker for epithelial-derived tumors. It is found on baso-lateral surfaces of most simple epithelia and many carcinoma types, and can distinguish adenocarcinomas from pleural mesotheliomas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.