CacheBy
Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody
원본

Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody

상품 한눈에 보기

EpCAM(CD326)을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, Flow Cytometry, ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. EpCAM 관련 암 연구 및 세포접착 단백질 분석에 적합.

카탈로그번호
PA579207
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 08:12
Thermo Fisher Scientific PA579207 EpCAM (CD326) Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells
ELISA 0.1–0.5 µg/mL

Product Specifications

Specification Description
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147–189 aa: ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains No preservative
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746323

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Ep-CAM (epithelial adhesion molecule, ESA) is a transmembrane glycoprotein (~40 kDa) expressed in epithelial tissues. It functions as a calcium-independent cell adhesion molecule and influences cell cycle, proliferation, and metabolism by inducing proto-oncogene c-myc and cyclins A and E.
Ep-CAM-mediated adhesions negatively regulate cadherin-mediated adhesions, affecting epithelial differentiation and growth. Overexpression of Ep-CAM is associated with enhanced epithelial proliferation and is highly expressed in human carcinomas, serving as a marker for epithelial-derived tumors. It is found on baso-lateral surfaces of most simple epithelia and many carcinoma types, and can distinguish adenocarcinomas from pleural mesotheliomas.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.