CacheBy
Thermo Fisher Scientific ELF1 Polyclonal Antibody
원본
Thermo Fisher Scientific

Thermo Fisher Scientific ELF1 Polyclonal Antibody

상품 한눈에 보기

ELF1 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat에 반응합니다. Western blot에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 PBS/trehalose buffer에 재구성하여 사용합니다.

브랜드
Thermo Fisher Scientific
카테고리
Polyclonal Antibodies
판매단위
pk

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 02:04
Thermo Fisher Scientific PA579200 ELF1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Thermo Fisher Scientific · Thermo Fisher Scientific ELF1 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746316

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes an E26 transformation-specific related transcription factor.
The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes.
Alternative splicing results in multiple transcript variants.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

ELF1 Antigen Image
ELF1 Antigen PDP Image

Thermo Fisher Scientific 상품 둘러보기

전체보기
Thermo Fisher ScientificThermo Fisher Scientific Epigen Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific EPB41L1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Emerin Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific EpCAM (CD326) Polyclonal Antibody568,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.