
원본
Thermo Fisher Scientific Emerin Polyclonal Antibody
상품 한눈에 보기
Emerin 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF, Flow Cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 Lyophilized 형태이며, 재구성 시 500 µg/mL 농도 제공. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 05:43
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579201 Emerin Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Emerin Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human Emerin (1–48aa: MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746317 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Xeroderma pigmentosum type G (XPG)는 태양광에 대한 극도의 민감성을 보이는 인간 유전 질환입니다. XPG 단백질은 FEN-1 구조 특이적 DNA 수선 엔도뉴클레아제 계열에 속하며, 자외선에 의해 유도된 DNA 손상의 수선에 필수적인 효소입니다. 인간 XPG 뉴클레아제는 뉴클레오타이드 절제 수선 과정에서 3' 절단을 수행하며, DNA 버블 구조를 절단합니다. 인간 XPG의 29-아미노산 영역(981–1009)은 PCNA 결합 활성을 가지며, Arg992 잔기가 이 결합에 중요합니다. 또한 RPA 단백질은 XPA 및 XPG 단백질과 직접적으로 결합하여 손상 인식 및 절제 수선에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
