Atlas Antibodies Anti-ETFBKMT Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA039024-100 | - | Atlas Antibodies HPA039024-100 Anti-ETFBKMT Antibody, electron transfer flavoprotein beta subunit lysine methyltransferase 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA039024-25 | - | Atlas Antibodies HPA039024-25 Anti-ETFBKMT Antibody, electron transfer flavoprotein beta subunit lysine methyltransferase 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-ETFBKMT Antibody
electron transfer flavoprotein beta subunit lysine methyltransferase
Recommended Applications
Product Description
Polyclonal Antibody against Human ETFBKMT
Alternative Gene Names
C12orf72, DKFZp451L235, METTL20, MGC50559
Target Protein
electron transfer flavoprotein beta subunit lysine methyltransferase
Target Gene
ETFBKMT
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
PYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000039958 (95%)
Rat ENSRNOG00000036918 (95%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|