
Atlas Antibodies Anti-ETFB Antibody
상품 한눈에 보기
인간 ETFB 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형식으로 정제된 고순도 항체. 인간, 생쥐, 랫드에 교차 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ETFB Antibody
Target: electron-transfer-flavoprotein, beta polypeptide (ETFB)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent validation by comparing antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ETFB.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | electron-transfer-flavoprotein, beta polypeptide |
| Target Gene | ETFB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000017851 (93%), Mouse ENSMUSG00000004610 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ETFDH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ETFBKMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ETFB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ETFA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ESYT2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.