CacheBy
Atlas Antibodies Anti-ETFA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ETFA Antibody

상품 한눈에 보기

Human ETFA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증으로 높은 신뢰성 확보. Human, Mouse, Rat에서 반응성이 확인됨. 친화정제 방식으로 높은 특이도 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018990-100 Anti-ETFA Antibody, electron-transfer-flavoprotein, alpha polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018990-25 Anti-ETFA Antibody, electron-transfer-flavoprotein, alpha polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ETFA Antibody

Anti-ETFA Antibody

Target: electron-transfer-flavoprotein, alpha polypeptide
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ETFA.

Alternative Gene Names: EMA, GA2, MADD
Target Gene: ETFA
Target Protein: electron-transfer-flavoprotein, alpha polypeptide

Open Datasheet


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEILK

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000015233 100%
Mouse ENSMUSG00000032314 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.