AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ERP44 Antibody
상품 한눈에 보기
Human ERP44 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. ERP44 관련 단백질 연구 및 ER 단백질 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001318-100 Anti-ERP44 Antibody, endoplasmic reticulum protein 44 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001318-25 Anti-ERP44 Antibody, endoplasmic reticulum protein 44 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERP44 Antibody
Anti-ERP44 Antibody
Overview
Polyclonal antibody against Human ERP44 (Endoplasmic Reticulum Protein 44).
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
- Type: Polyclonal Antibody
- Target Protein: Endoplasmic Reticulum Protein 44 (ERP44)
- Alternative Gene Names: KIAA0573, PDIA10, TXNDC4
- Host: Rabbit
- Isotype: IgG
- Verified Species Reactivity: Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000028343): 90%
- Rat (ENSRNOG00000005841): 90%
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.