
Atlas Antibodies Anti-ERP44 Antibody
상품 한눈에 보기
Human ERP44 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. ERP44 관련 단백질 연구 및 ER 단백질 분석에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ERP44 Antibody
Overview
Polyclonal antibody against Human ERP44 (Endoplasmic Reticulum Protein 44).
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
- Type: Polyclonal Antibody
- Target Protein: Endoplasmic Reticulum Protein 44 (ERP44)
- Alternative Gene Names: KIAA0573, PDIA10, TXNDC4
- Host: Rabbit
- Isotype: IgG
- Verified Species Reactivity: Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000028343): 90%
- Rat (ENSRNOG00000005841): 90%
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ERVMER34-1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ESAM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP29 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.