Atlas Antibodies Anti-ERP29 Antibody

상품 한눈에 보기

Human ERP29 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 Western blot에 적합합니다. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039363-100 Anti-ERP29 Antibody, endoplasmic reticulum protein 29 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039363-25 Anti-ERP29 Antibody, endoplasmic reticulum protein 29 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ERP29 Antibody

Anti-ERP29 Antibody

Target: Endoplasmic reticulum protein 29 (ERP29)
Type: Polyclonal Antibody against Human ERP29

Recommended Applications

Orthogonal validation: Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Independent validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against Human ERP29.

Alternative Gene Names

C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Endoplasmic reticulum protein 29
Target Gene	ERP29
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Verified Species Reactivity	Human
Interspecies Identity	Rat (88%), Mouse (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.