
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ERP29 Antibody
상품 한눈에 보기
Human ERP29 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 Western blot에 적합합니다. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039363-100 Anti-ERP29 Antibody, endoplasmic reticulum protein 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039363-25 Anti-ERP29 Antibody, endoplasmic reticulum protein 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERP29 Antibody
Anti-ERP29 Antibody
Target: Endoplasmic reticulum protein 29 (ERP29)
Type: Polyclonal Antibody against Human ERP29
Recommended Applications
- Orthogonal validation: Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Independent validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human ERP29.
Alternative Gene Names
C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic reticulum protein 29 |
| Target Gene | ERP29 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (87%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



