
Atlas Antibodies Anti-ERP29 Antibody
상품 한눈에 보기
Human ERP29 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 Western blot에 적합합니다. Orthogonal 및 Independent validation으로 검증된 신뢰성 높은 항체입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ERP29 Antibody
Target: Endoplasmic reticulum protein 29 (ERP29)
Type: Polyclonal Antibody against Human ERP29
Recommended Applications
- Orthogonal validation: Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Independent validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human ERP29.
Alternative Gene Names
C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic reticulum protein 29 |
| Target Gene | ERP29 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (87%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ERP44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERO1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERP27 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.