
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ESAM Antibody
상품 한눈에 보기
Human ESAM을 인식하는 Rabbit Polyclonal Antibody로, 내피세포 부착분자 연구에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 사용 가능하며, 40% glycerol 기반의 안정화 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051043-100 Anti-ESAM Antibody, endothelial cell adhesion molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051043-25 Anti-ESAM Antibody, endothelial cell adhesion molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ESAM Antibody
Anti-ESAM Antibody
Target Information
- Full Name: Endothelial cell adhesion molecule (ESAM)
- Alternative Gene Name: W117m
- Target Gene: ESAM
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
Product Description
Polyclonal antibody against human ESAM, produced in rabbit. Suitable for various immunoassay applications.
Recommended Applications
- Immunocytochemistry (ICC)
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000033217 | 72% |
| Mouse | ENSMUSG00000001946 | 72% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Base Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



