
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ERP27 Antibody
상품 한눈에 보기
Human ERP27 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot 검증 완료. PrEST 항원을 이용해 친화 정제됨. 인간 시료에 반응하며, RNA-seq 기반 직교 검증 데이터 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052851-100 Anti-ERP27 Antibody, endoplasmic reticulum protein 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052851-25 Anti-ERP27 Antibody, endoplasmic reticulum protein 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERP27 Antibody
Anti-ERP27 Antibody
Target: Endoplasmic Reticulum Protein 27 (ERP27)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant Expression Validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody against human ERP27.
Alternative Gene Names
C12orf46, ERp27, FLJ32115, PDIA8
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030219 | 66% |
| Rat | ENSRNOG00000005787 | 57% |
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage & Handling | Gently mix before use. Optimize concentration and conditions per application. |
| Safety | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



