CacheBy
Atlas Antibodies Anti-ENTPD5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ENTPD5 Antibody

상품 한눈에 보기

인간 ENTPD5 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교하여 단백질 발현 검증이 가능합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002927-100 Anti-ENTPD5 Antibody, ectonucleoside triphosphate diphosphohydrolase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002927-25 Anti-ENTPD5 Antibody, ectonucleoside triphosphate diphosphohydrolase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENTPD5 Antibody

Anti-ENTPD5 Antibody

Target: ectonucleoside triphosphate diphosphohydrolase 5
Supplier: Atlas Antibodies

  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human ENTPD5.

Alternative Gene Names

  • CD39L4
  • NTPDase-5
  • PCPH

Open Datasheet

Target Information

항목 내용
Target Protein ectonucleoside triphosphate diphosphohydrolase 5
Target Gene ENTPD5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (88%), Rat (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.