CacheBy
Atlas Antibodies Anti-ENTPD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ENTPD2 Antibody

상품 한눈에 보기

Human ENTPD2를 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. CD39L1/NTPDase-2 대체명으로 알려진 단백질 인식. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017676-100 Anti-ENTPD2 Antibody, ectonucleoside triphosphate diphosphohydrolase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017676-25 Anti-ENTPD2 Antibody, ectonucleoside triphosphate diphosphohydrolase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENTPD2 Antibody

Anti-ENTPD2 Antibody

Target Protein: ectonucleoside triphosphate diphosphohydrolase 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human ENTPD2.


Alternative Gene Names

CD39L1, NTPDase-2

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein ectonucleoside triphosphate diphosphohydrolase 2
Target Gene ENTPD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGW
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000013102 (87%), Mouse ENSMUSG00000015085 (86%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.