CacheBy
Atlas Antibodies Anti-ENTPD8 Antibody
원본

Atlas Antibodies Anti-ENTPD8 Antibody

상품 한눈에 보기

인간 ENTPD8 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 높은 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021509-100 Anti-ENTPD8 Antibody, ectonucleoside triphosphate diphosphohydrolase 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021509-25 Anti-ENTPD8 Antibody, ectonucleoside triphosphate diphosphohydrolase 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENTPD8 Antibody

Anti-ENTPD8 Antibody

ectonucleoside triphosphate diphosphohydrolase 8

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ENTPD8.

Alternative Gene Names

  • NTPDase-8
  • UNQ2492

Open Datasheet

Target Information

항목 내용
Target Protein ectonucleoside triphosphate diphosphohydrolase 8
Target Gene ENTPD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009239 (81%), Mouse ENSMUSG00000036813 (80%)

Antigen Sequence:

SHTSLFLYQWPANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGLG

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.