
Atlas Antibodies Anti-ENPP5 Antibody
상품 한눈에 보기
인간 ENPP5 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 정제된 PrEST 항원을 이용한 검증 완료. 고순도 IgG, 친화 정제 방식으로 높은 특이성과 재현성 보장. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ENPP5 Antibody
Target: ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative)
Product Type: Polyclonal Antibody against Human ENPP5
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant expression validation): Validation using target protein overexpression.
Product Description
This polyclonal antibody is produced in rabbit and affinity purified using the recombinant PrEST antigen as affinity ligand. It is validated for applications in immunohistochemistry (IHC) and western blot (WB).
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative) |
| Target Gene | ENPP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSE |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000010232 (86%), Mouse ENSMUSG00000023960 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ENPP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENTHD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENPP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENPP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENPP6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.