
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ENPP5 Antibody
상품 한눈에 보기
인간 ENPP5 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 정제된 PrEST 항원을 이용한 검증 완료. 고순도 IgG, 친화 정제 방식으로 높은 특이성과 재현성 보장. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016902-100 Anti-ENPP5 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016902-25 Anti-ENPP5 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ENPP5 Antibody
Anti-ENPP5 Antibody
Target: ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative)
Product Type: Polyclonal Antibody against Human ENPP5
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant expression validation): Validation using target protein overexpression.
Product Description
This polyclonal antibody is produced in rabbit and affinity purified using the recombinant PrEST antigen as affinity ligand. It is validated for applications in immunohistochemistry (IHC) and western blot (WB).
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative) |
| Target Gene | ENPP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSE |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000010232 (86%), Mouse ENSMUSG00000023960 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



