CacheBy
Atlas Antibodies Anti-ENPP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ENPP3 Antibody

상품 한눈에 보기

Human ENPP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 Orthogonal 검증에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 조직 발현 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043772-100 Anti-ENPP3 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043772-25 Anti-ENPP3 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENPP3 Antibody

Anti-ENPP3 Antibody

Target: ectonucleotide pyrophosphatase/phosphodiesterase 3 (ENPP3)
Type: Polyclonal Antibody against Human ENPP3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit, targeting human ENPP3 protein.

Alternative Gene Names

B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ectonucleotide pyrophosphatase/phosphodiesterase 3
Target Gene ENPP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013791 (82%), Mouse ENSMUSG00000019989 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.