Atlas Antibodies Anti-ENPP6 Antibody

상품 한눈에 보기

Human ENPP6 단백질을 표적으로 하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가짐. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042740-100 Anti-ENPP6 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042740-25 Anti-ENPP6 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ENPP6 Antibody

Anti-ENPP6 Antibody

Target Information

Target Protein: ectonucleotide pyrophosphatase/phosphodiesterase 6
Target Gene: ENPP6
Alternative Gene Name: MGC33971

Product Description

Polyclonal antibody against human ENPP6.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000009660 (92%)
Mouse ENSMUSG00000038173 (92%)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Verified Species Reactivity	Human
Alternative Gene Names	MGC33971