
Atlas Antibodies Anti-SLC6A16 Antibody
상품 한눈에 보기
Human SLC6A16 단백질을 인식하는 토끼 유래 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 글리세롤 기반 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC6A16 Antibody
Target: solute carrier family 6, member 16 (SLC6A16)
Type: Polyclonal Antibody against Human SLC6A16
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human SLC6A16 protein.
Purified by affinity chromatography using the PrEST antigen as ligand.
Alternative Gene Names
- NTT5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 6, member 16 |
| Target Gene | SLC6A16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000025220 (66%), Mouse ENSMUSG00000094152 (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- Contains 0.02% sodium azide as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC6A18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A17 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.