CacheBy
Atlas Antibodies Anti-SLC6A15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A15 Antibody

상품 한눈에 보기

Human SLC6A15 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA008609-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008609-100 Anti-SLC6A15 Antibody, solute carrier family 6 (neutral amino acid transporter), member 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008609-25 Anti-SLC6A15 Antibody, solute carrier family 6 (neutral amino acid transporter), member 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A15 Antibody

Anti-SLC6A15 Antibody

Target: Solute carrier family 6 (neutral amino acid transporter), member 15
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC6A15


Alternative Gene Names

FLJ10316, hv7-3, NTT73, SBAT1, V7-3


Target Information

항목 내용
Target Protein Solute carrier family 6 (neutral amino acid transporter), member 15
Target Gene SLC6A15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027468 (80%), Mouse ENSMUSG00000019894 (77%)

Antigen Sequence:
RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.