CacheBy
Atlas Antibodies Anti-SLC6A18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A18 Antibody

상품 한눈에 보기

Human SLC6A18 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal Validation을 통해 검증됨. PrEST 항원을 이용해 Affinity 정제되었으며, Human에 반응. FLJ31236, Xtrp2 대체 유전자명 포함. PBS와 glycerol buffer로 안정화.

카탈로그번호
HPA011885-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011885-100 Anti-SLC6A18 Antibody, solute carrier family 6 (neutral amino acid transporter), member 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011885-25 Anti-SLC6A18 Antibody, solute carrier family 6 (neutral amino acid transporter), member 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A18 Antibody

Anti-SLC6A18 Antibody

solute carrier family 6 (neutral amino acid transporter), member 18


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC6A18


Alternative Gene Names

FLJ31236, Xtrp2

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 6 (neutral amino acid transporter), member 18
Target Gene SLC6A18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016253 (81%), Mouse ENSMUSG00000021612 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.