
Atlas Antibodies Anti-SLC6A18 Antibody
상품 한눈에 보기
Human SLC6A18 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal Validation을 통해 검증됨. PrEST 항원을 이용해 Affinity 정제되었으며, Human에 반응. FLJ31236, Xtrp2 대체 유전자명 포함. PBS와 glycerol buffer로 안정화.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC6A18 Antibody
solute carrier family 6 (neutral amino acid transporter), member 18
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC6A18
Alternative Gene Names
FLJ31236, Xtrp2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 6 (neutral amino acid transporter), member 18 |
| Target Gene | SLC6A18 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000016253 (81%), Mouse ENSMUSG00000021612 (80%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC6A7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.