
Atlas Antibodies Anti-SLC5A2 Antibody
Human SLC5A2(SGLT2)을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. 고순도 Affinity 정제 제품이며, Human에 반응. RNA-seq 기반 Orthogonal validation으로 높은 신뢰도 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC5A2 Antibody
solute carrier family 5 (sodium/glucose cotransporter), member 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC5A2
Alternative Gene Names
- SGLT2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 5 (sodium/glucose cotransporter), member 2 |
| Target Gene | SLC5A2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000020039 (91%), Mouse ENSMUSG00000030781 (89%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC6A12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|