CacheBy
Atlas Antibodies Anti-SLC5A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC5A2 Antibody

상품 한눈에 보기

Human SLC5A2(SGLT2)을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. 고순도 Affinity 정제 제품이며, Human에 반응. RNA-seq 기반 Orthogonal validation으로 높은 신뢰도 제공.

카탈로그번호
HPA041603-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041603-100 Anti-SLC5A2 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041603-25 Anti-SLC5A2 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC5A2 Antibody

Anti-SLC5A2 Antibody

solute carrier family 5 (sodium/glucose cotransporter), member 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC5A2


Alternative Gene Names

  • SGLT2

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 5 (sodium/glucose cotransporter), member 2
Target Gene SLC5A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020039 (91%), Mouse ENSMUSG00000030781 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.