Atlas Antibodies Anti-SLC5A11 Antibody

상품 한눈에 보기

인간 SLC5A11 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성. 안정적인 PBS/glycerol 버퍼에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035331-100 Anti-SLC5A11 Antibody, solute carrier family 5 (sodium/inositol cotransporter), member 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035331-25 Anti-SLC5A11 Antibody, solute carrier family 5 (sodium/inositol cotransporter), member 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: solute carrier family 5 (sodium/inositol cotransporter), member 11
Supplier: Atlas Antibodies

Polyclonal antibody against Human SLC5A11

KST1, SGLT6, SMIT2

Target Protein: solute carrier family 5 (sodium/inositol cotransporter), member 11
Target Gene: SLC5A11
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000013407	63%
Mouse	ENSMUSG00000030769	61%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative (Material Safety Data Sheet)