
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC5A5 Antibody
상품 한눈에 보기
인체 SLC5A5 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인됨. 40% glycerol 기반 PBS 버퍼에 sodium azide 포함.
- 카탈로그번호
- HPA049055-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049055-100 Anti-SLC5A5 Antibody, solute carrier family 5 (sodium/iodide cotransporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049055-25 Anti-SLC5A5 Antibody, solute carrier family 5 (sodium/iodide cotransporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC5A5 Antibody
Anti-SLC5A5 Antibody
Target: solute carrier family 5 (sodium/iodide cotransporter), member 5
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC5A5
Alternative Gene Names
NIS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 5 (sodium/iodide cotransporter), member 5 |
| Target Gene | SLC5A5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000000792 | 48% |
| Rat | ENSRNOG00000018822 | 47% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



