CacheBy
Atlas Antibodies Anti-SLC5A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC5A5 Antibody

상품 한눈에 보기

인체 SLC5A5 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인됨. 40% glycerol 기반 PBS 버퍼에 sodium azide 포함.

카탈로그번호
HPA049055-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049055-100 Anti-SLC5A5 Antibody, solute carrier family 5 (sodium/iodide cotransporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049055-25 Anti-SLC5A5 Antibody, solute carrier family 5 (sodium/iodide cotransporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC5A5 Antibody

Anti-SLC5A5 Antibody

Target: solute carrier family 5 (sodium/iodide cotransporter), member 5
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC5A5

Alternative Gene Names

NIS

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein solute carrier family 5 (sodium/iodide cotransporter), member 5
Target Gene SLC5A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000000792 48%
Rat ENSRNOG00000018822 47%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.