
Atlas Antibodies Anti-SLC52A3 Antibody
상품 한눈에 보기
Human SLC52A3 단백질을 인식하는 Rabbit Polyclonal 항체로, 리보플라빈 수송체 연구에 적합. Affinity purification 방식으로 제조되었으며, IHC 등 다양한 응용에 사용 가능. Human에 반응하며 안정한 PBS/glycerol buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC52A3 Antibody
Target: solute carrier family 52 (riboflavin transporter), member 3
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human SLC52A3 (solute carrier family 52, riboflavin transporter, member 3).
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
bA371L19.1, C20orf54, hRFT2, RFVT3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 52 (riboflavin transporter), member 3 |
| Target Gene | SLC52A3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000005132 (50%), Mouse ENSMUSG00000027463 (50%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC52A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC51B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC52A3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.