CacheBy
Atlas Antibodies Anti-SLC51B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC51B Antibody

상품 한눈에 보기

인간 SLC51B 단백질을 타겟으로 하는 토끼 유래 폴리클로날 항체입니다. IHC 및 WB에서 RNA-seq 데이터와 비교한 Orthogonal 검증 수행. 높은 특이성과 재현성을 제공하며, 친화성 정제된 고품질 항체입니다.

카탈로그번호
HPA008533-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008533-100 Anti-SLC51B Antibody, solute carrier family 51, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008533-25 Anti-SLC51B Antibody, solute carrier family 51, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC51B Antibody

Anti-SLC51B Antibody

Target: solute carrier family 51, beta subunit (SLC51B)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against human SLC51B.

Alternative Gene Name: OSTbeta
Target Protein: solute carrier family 51, beta subunit
Target Gene: SLC51B
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE

Open Datasheet


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053862 60%
Rat ENSRNOG00000028889 56%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.