
Atlas Antibodies Anti-SLC51B Antibody
인간 SLC51B 단백질을 타겟으로 하는 토끼 유래 폴리클로날 항체입니다. IHC 및 WB에서 RNA-seq 데이터와 비교한 Orthogonal 검증 수행. 높은 특이성과 재현성을 제공하며, 친화성 정제된 고품질 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC51B Antibody
Target: solute carrier family 51, beta subunit (SLC51B)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human SLC51B.
Alternative Gene Name: OSTbeta
Target Protein: solute carrier family 51, beta subunit
Target Gene: SLC51B
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000053862 | 60% |
| Rat | ENSRNOG00000028889 | 56% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC52A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC51B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC52A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC52A2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|