
Atlas Antibodies Anti-SLC51B Antibody
인간 SLC51B 단백질을 타겟으로 하는 토끼 유래 폴리클로날 항체입니다. IHC 및 WB에서 RNA-seq 데이터와 비교한 Orthogonal 검증 수행. 높은 특이성과 재현성을 제공하며, 친화성 정제된 고품질 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-SLC51B Antibody
Anti-SLC51B Antibody
Target: solute carrier family 51, beta subunit (SLC51B)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human SLC51B.
Alternative Gene Name: OSTbeta
Target Protein: solute carrier family 51, beta subunit
Target Gene: SLC51B
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000053862 | 60% |
| Rat | ENSRNOG00000028889 | 56% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



