CacheBy
Atlas Antibodies Anti-SLC5A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC5A1 Antibody

상품 한눈에 보기

인간 SLC5A1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증으로 단백질 발현 신뢰도를 확보했습니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA051805-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051805-100 Anti-SLC5A1 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051805-25 Anti-SLC5A1 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC5A1 Antibody

Anti-SLC5A1 Antibody

Target: solute carrier family 5 (sodium/glucose cotransporter), member 1
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC5A1


Alternative Gene Names

D22S675, NAGT, SGLT1

Open Datasheet


Specifications

항목 내용
Target Protein solute carrier family 5 (sodium/glucose cotransporter), member 1
Target Gene SLC5A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000011034 (76%), Rat ENSRNOG00000017775 (71%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet MSDS - Sodium Azide

Antigen Sequence

DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.