
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC5A1 Antibody
상품 한눈에 보기
인간 SLC5A1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증으로 단백질 발현 신뢰도를 확보했습니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA051805-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051805-100 Anti-SLC5A1 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051805-25 Anti-SLC5A1 Antibody, solute carrier family 5 (sodium/glucose cotransporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC5A1 Antibody
Anti-SLC5A1 Antibody
Target: solute carrier family 5 (sodium/glucose cotransporter), member 1
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC5A1
Alternative Gene Names
D22S675, NAGT, SGLT1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 5 (sodium/glucose cotransporter), member 1 |
| Target Gene | SLC5A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000011034 (76%), Rat ENSRNOG00000017775 (71%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Material Safety Data Sheet | MSDS - Sodium Azide |
Antigen Sequence
DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



