CacheBy
Atlas Antibodies Anti-SLC43A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC43A2 Antibody

상품 한눈에 보기

Human SLC43A2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 높은 특이성과 재현성을 제공합니다. PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021564-100 Anti-SLC43A2 Antibody, solute carrier family 43 (amino acid system L transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021564-25 Anti-SLC43A2 Antibody, solute carrier family 43 (amino acid system L transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC43A2 Antibody

Anti-SLC43A2 Antibody

Target: solute carrier family 43 (amino acid system L transporter), member 2
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human SLC43A2.


Alternative Gene Names

  • MGC34680

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 43 (amino acid system L transporter), member 2
Target Gene SLC43A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003835 (91%), Mouse ENSMUSG00000038178 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.