CacheBy
Atlas Antibodies Anti-SLC41A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC41A1 Antibody

상품 한눈에 보기

Human SLC41A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA015138-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015138-100 Anti-SLC41A1 Antibody, solute carrier family 41 (magnesium transporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015138-25 Anti-SLC41A1 Antibody, solute carrier family 41 (magnesium transporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC41A1 Antibody

Anti-SLC41A1 Antibody

Target: solute carrier family 41 (magnesium transporter), member 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SLC41A1.


Alternative Gene Names

  • MgtE

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 41 (magnesium transporter), member 1
Target Gene SLC41A1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치도
Mouse ENSMUSG00000013275 95%
Rat ENSRNOG00000042320 95%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.