CacheBy
Atlas Antibodies Anti-SLC43A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC43A3 Antibody

상품 한눈에 보기

Human SLC43A3 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Rat 및 Mouse와도 부분적 교차 반응성이 있습니다.

카탈로그번호
HPA030551-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030551-100 Anti-SLC43A3 Antibody, solute carrier family 43, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030551-25 Anti-SLC43A3 Antibody, solute carrier family 43, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC43A3 Antibody

Anti-SLC43A3 Antibody

Target Information

  • Target Protein: Solute carrier family 43, member 3
  • Target Gene: SLC43A3
  • Alternative Gene Names: DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1

Product Description

Polyclonal antibody against Human SLC43A3.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Rat (ENSRNOG00000061768) – 63% identity
    • Mouse (ENSMUSG00000027074) – 60% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.