
Atlas Antibodies Anti-SLC3A2 Antibody
Human SLC3A2 단백질을 인식하는 토끼 유래 폴리클론 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA017980-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-SLC3A2 Antibody
Anti-SLC3A2 Antibody
solute carrier family 3 (amino acid transporter heavy chain), member 2
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression using IHC is verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human SLC3A2.
Alternative Gene Names
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 3 (amino acid transporter heavy chain), member 2 |
| Target Gene | SLC3A2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (74%), Mouse (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence:
KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



