CacheBy
Atlas Antibodies Anti-SLC25A15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A15 Antibody

상품 한눈에 보기

Human SLC25A15 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, Human에 대해 검증되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042146-100 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042146-25 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A15 Antibody

Anti-SLC25A15 Antibody

Target: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Supplier: Atlas Antibodies

Immunohistochemistry (IHC) 등 다양한 응용에 적합

Product Description

Polyclonal Antibody against Human SLC25A15

Alternative Gene Names

D13S327, HHH, ORC1, ORNT1

Open Datasheet

Target Information

  • Target Protein: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
  • Target Gene: SLC25A15

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTACVLTGQPFDTIKVKMQTFPDLYKGLTD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031482 (93%)
  • Rat ENSRNOG00000011881 (93%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 실험적으로 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.