Atlas Antibodies Anti-SLC25A15 Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA042146-100 | - | Atlas Antibodies HPA042146-100 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA042146-25 | - | Atlas Antibodies HPA042146-25 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SLC25A15 Antibody
solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC25A15
Alternative Gene Names
D13S327, HHH, ORC1, ORNT1
Target Protein
solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Target Gene
SLC25A15
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
GTACVLTGQPFDTIKVKMQTFPDLYKGLTD
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000031482 (93%)
Rat ENSRNOG00000011881 (93%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|