Atlas Antibodies Anti-SLC25A15 Antibody

상품 한눈에 보기

Human SLC25A15 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, Human에 대해 검증되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호: HPA042146-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042146-100 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042146-25 Anti-SLC25A15 Antibody, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC25A15 Antibody

Anti-SLC25A15 Antibody

Target: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC) 등 다양한 응용에 적합

Product Description

Polyclonal Antibody against Human SLC25A15

Alternative Gene Names

D13S327, HHH, ORC1, ORNT1

Open Datasheet

Target Information

Target Protein: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Target Gene: SLC25A15

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTACVLTGQPFDTIKVKMQTFPDLYKGLTD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031482 (93%)
Rat ENSRNOG00000011881 (93%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand