CacheBy
Atlas Antibodies Anti-SLC25A11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A11 Antibody

상품 한눈에 보기

Human SLC25A11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. 인간, 생쥐, 랫트에 높은 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021167-100 Anti-SLC25A11 Antibody, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021167-25 Anti-SLC25A11 Antibody, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A11 Antibody

Anti-SLC25A11 Antibody

solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human SLC25A11

Alternative Gene Names

OGC, SLC20A4

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
Target Gene SLC25A11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK

Verified Species Reactivity

Human

Interspecies Information

Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000003815 99%
Mouse ENSMUSG00000014606 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 사용 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.