CacheBy
Atlas Antibodies Anti-SLC25A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A10 Antibody

상품 한눈에 보기

Human SLC25A10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Affinity purification 방식으로 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 인간에 특이적으로 반응하며, DIC 유전자명을 갖습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023048-100 Anti-SLC25A10 Antibody, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023048-25 Anti-SLC25A10 Antibody, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A10 Antibody

Anti-SLC25A10 Antibody

Target: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SLC25A10.


Alternative Gene Names

  • DIC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Target Gene SLC25A10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000025792 (80%), Rat ENSRNOG00000036693 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.