CacheBy
Atlas Antibodies Anti-SLC25A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A10 Antibody

상품 한눈에 보기

Human SLC25A10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Affinity purification 방식으로 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 인간에 특이적으로 반응하며, DIC 유전자명을 갖습니다.

카탈로그번호
HPA023048-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023048-100 Anti-SLC25A10 Antibody, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023048-25 Anti-SLC25A10 Antibody, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A10 Antibody

Anti-SLC25A10 Antibody

Target: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SLC25A10.


Alternative Gene Names

  • DIC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Target Gene SLC25A10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000025792 (80%), Rat ENSRNOG00000036693 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.